Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Claudin 18 (CLDN18) antibody

Antigen

Claudin 18 (CLDN18)

Synonyms SFTA5, SFTPJ, DKFZp564B2062, MGC68719, claudin-18, CLDN18, MGC140810
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN404887
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Claudin-18 / CLDN18
Gene ID CLDN18
UniProt P56856
Immunogen The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the middle region of human CLDN18
Sequence YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE VQSYPSKHDY
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CLDN18 antibody concentration is 1 mg/ml.
Description CLDN18 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001 [PubMed 11585919]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-282 AY358479.1 28-309 283-1864 AK098474.1 274-1855 1865-2307 BM785703.1 143-585 2308-2868 AK098474.1 2297-2857 2869-3359 AY102073.1 394-884
Characteristics Antigen Size: 261 amino acids
Molecular Weight 28kDa

Application Details

Application Notes WB Suggested Anti-CLDN18 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Karanjawala, Illei, Ashfaq et al.: "New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8." in: The American journal of surgical pathology, Vol. 32, Issue 2, pp. 188-96, 2008 (PubMed).

Alternatives

Alternatives for antigen "Claudin 18 (CLDN18)", type "Antibodies"
Hosts Rabbit (15)
Reactivities Human (11), Mouse (Murine) (6), Rat (Rattus) (5), Cow (Bovine) (2), Dog (Canine) (2), Cat (Feline) (1), Chicken (1), Pig (Porcine) (1)
Applications Western Blotting (WB) (15), ELISA (8), Immunohistochemistry (IHC) (3), Immunofluorescence (IF) (2), Flow Cytometry (FACS) (1), Immunohistochemistry (Fixed) (IHC (fx)) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1), Immunoprecipitation (IP) (1)
Epitopes C-Term (3), Internal Region (2), Center (1)