Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404964

Nuclear Transcription Factor, X-Box Binding 1 (NFX1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NFX2, NFX.1, Tex42, TEG-42, 1300017N15Rik, 3000003M19Rik, NFX1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404964
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NFX1 antibody: synthetic peptide directed towards the N terminal of human NFX1
Sequence MAEAPPVSGTFKFNTDAAEFIPQEKKNSGLNCGTQRRLDS NRIGRRNYSS
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Horse : 92%, Mouse : 92%, Pig : 92%, Rabbit : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against NFX1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NFX1
Background NFX1 binds to the X-box motif of MHC class II genes and represses their expression. NFX1 may play an important role in regulating the duration of an inflammatory response by limiting the period in which MHC class II molecules are induced by interferon-gamma. Isoform 3 binds to the X-box motif of TERT promoter and represses its expression. Together with PABPC1 or PABPC4, isoform 1 acts as a coactivator for TERT expression. NFX1 mediates E2-dependent ubiquitination.MHC class II gene expression is controlled primarily at the transcriptional level by transcription factors that bind to the X and Y boxes, two highly conserved elements in the proximal promoter of MHC class II genes. The protein encoded by this gene is a transcriptional repressor capable of binding to the conserved X box motif of HLA-DRA and other MHC class II genes in vitro. The protein may play a role in regulating the duration of an inflammatory response by limiting the period in which class II MHC molecules are induced by IFN-gamma. Three alternative splice variants, each of which encodes a different isoform, have been identified.
Molecular Weight 113kDa
Gene ID 4799
NCBI Accession NP_667344, NM_147133
UniProt Q12986-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Proteolysis / Ubiquitin, Adaptive Immunity
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NFX1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Katzenellenbogen, Egelkrout, Vliet-Gregg et al.: "NFX1-123 and poly(A) binding proteins synergistically augment activation of telomerase in human papillomavirus type 16 E6-expressing cells." in: Journal of virology, Vol. 81, Issue 8, pp. 3786-96, 2007 (PubMed).

Alternatives for antigen "Nuclear Transcription Factor, X-Box Binding 1 (NFX1)", type "Antibodies"
Hosts (18), (4)
Reactivities (22), (15), (15), (1), (1)
Applications (12), (11), (10), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (1), (1)
Beacon