Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405098

Annexin A8-Like 2 (ANXA8L2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANXA8, bA145E20.2, ANXA8L1, ANXA8L2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Rat (Rattus), Mouse (Murine), Cow (Bovine), Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405098
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ANXA8L2 antibody: synthetic peptide directed towards the middle region of human ANXA8L2
Sequence VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLH SYFAERLYYA
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ANXA8L2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ANXA8L2
Background ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
Molecular Weight 37kDa
Gene ID 244
NCBI Accession NP_001621, NM_001630
UniProt P13928
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ANXA8L2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Karanjawala, Illei, Ashfaq et al.: "New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8." in: The American journal of surgical pathology, Vol. 32, Issue 2, pp. 188-96, 2008 (PubMed).

Alternatives for antigen "Annexin A8-Like 2 (ANXA8L2)", type "Antibodies"
Hosts (13)
Reactivities (10), (4), (4), (2), (2), (2), (2), (2)
Applications (11), (4), (1), (1), (1)
Epitopes (3), (1), (1), (1)
Beacon