Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 157 (ZNF157) (N-Term) antibody

Details for Product No. ABIN405155
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HZF22, 2610020C11Rik, A630094N24Rik, AI327407, mszf12, mszf23-1
Epitope
N-Term
(2), (2), (1), (1), (1)
Reactivity
Human
(7), (2)
Host
Rabbit
(4), (3), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (4), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405155
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF157
Sequence PANGTSPQRFPALIPGEPGRSFEGSVSFEDVAVDFTRQEW HRLDPAQRTM
Predicted Reactivity Horse : 92 %
Characteristics This is a rabbit polyclonal antibody against ZNF157. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF157
Background ZNF157 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF157 may be involved in transcriptional regulation. This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23.
Molecular Weight 58 kDa
Gene ID 7712
NCBI Accession NM_003446, NP_003437
UniProt P51786
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 506 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 157 (ZNF157) (N-Term) antibody WB Suggested Anti-ZNF157 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405155
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top