Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405155

Zinc Finger Protein 157 (ZNF157) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HZF22, 2610020C11Rik, A630094N24Rik, AI327407, mszf12, mszf23-1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405155
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF157 antibody: synthetic peptide directed towards the N terminal of human ZNF157
Sequence PANGTSPQRFPALIPGEPGRSFEGSVSFEDVAVDFTRQEW HRLDPAQRTM
Predicted Reactivity Horse : 92%
Characteristics This is a rabbit polyclonal antibody against ZNF157. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF157
Background ZNF157 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF157 may be involved in transcriptional regulation. This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23.
Molecular Weight 58kDa
Gene ID 7712
NCBI Accession NP_003437, NM_003446
UniProt P51786
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF157 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 157 (ZNF157)", type "Antibodies"
Hosts (4), (4), (1)
Reactivities (8), (1)
Applications (9), (4), (2), (2)
Epitopes (2), (2), (1), (1), (1)
Beacon