Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Zinc Finger Protein 157 (ZNF157) (AA 402-505) antibody Primary Antibody

ZNF157 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 3G3 unconjugated
Catalog No. ABIN521583
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Zinc Finger Protein 157 (ZNF157)
    Binding Specificity
    • 3
    • 2
    • 1
    • 1
    AA 402-505
    Reactivity
    • 9
    • 7
    • 2
    • 2
    • 1
    • 1
    Human
    Host
    • 7
    • 6
    • 3
    Mouse
    Clonality
    • 15
    • 1
    Monoclonal
    Conjugate
    • 10
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Un-conjugated
    Application
    • 15
    • 9
    • 2
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant ZNF157.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: ZNF157 (NP_003437.1, 402 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: IEHQRMHSGEKPYECSECGKIFSMKKSLCQHRRTHTGEKPYECSECGNAFYVKVRLIEHQRIHTGERPFECQECGKAFCRKAHLTEHQRTHIGWSWRCTMKKAS

    Clone
    3G3
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Zinc Finger Protein 157 (ZNF157)
    Alternative Name
    ZNF157 (ZNF157 Antibody Abstract)
    Synonyms
    HZF22, 2610020C11Rik, A630094N24Rik, AI327407, mszf12, mszf23-1, zinc finger protein 157, ZNF157, Zfp157
    Background
    Full Gene Name: zinc finger protein 157
    Synonyms: HZF22
    Gene ID
    7712
    NCBI Accession
    NP_003437, NM_003446
You are here:
help Support