Zinc Finger Protein 157 (ZNF157) antibody

Antigen: Zinc Finger Protein 157 (ZNF157)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN405155

Additional Information

Alternative name: ZNF157

Gene ID: ZNF157

UniProt: P51786

Immunogen: The immunogen for anti-ZNF157 antibody: synthetic peptide directed towards the N terminal of human ZNF157

Sequence: PANGTSPQRFPALIPGEPGRSFEGSVSFEDVAVDFTRQEW HRLDPAQRTM

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF157 antibody concentration is 1 mg/ml.

Description: ZNF157 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF157 may be involved in transcriptional regulation. This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-28 U28687.1 19-46 29-1620 BC075003.2 1-1592 1621-1695 CO245585.1 27-101 c

Characteristics: Antigen Size: 506 amino acids

Molecular Weight: 58kDa

Application Details

Application Notes: WB Suggested Anti-ZNF157 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF157 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

Publications

Product: Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).