Zinc Finger Protein 280C (ZNF280C) antibody

Antigen: Zinc Finger Protein 280C (ZNF280C)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN405216

Additional Information

Alternative name: SUHW3 / ZNF280C

Gene ID: ZNF280C

UniProt: Q8ND82

Immunogen: The immunogen for anti-ZNF280C antibody: synthetic peptide directed towards the N terminal of human ZNF280C

Sequence: DDDKPFQPKNISKMAELFMECEEEELEPWQKKVEETQDED DDELIFVGEI

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF280C antibody concentration is 1 mg/ml.

Description: ZNF280C contains 5 C2H2-type zinc fingers. It may function as a transcription factor.

Characteristics: Antigen Size: 737 amino acids

Molecular Weight: 83kDa

Application Details

Application Notes: WB Suggested Anti-ZNF280C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF280C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Publications

Product: Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).