Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405221

High-Mobility Group 20A (HMG20A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HMGX1, HMGXB1, Ibraf, Hmgxb1, 1200004E06Rik, 5730490E10Rik, RGD1564760, fe47h11, wu:fe47h11, zgc:162335, hmg20a, MGC82871, MGC89476
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405221
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A
Sequence ENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSG ATSSTNNPEF
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Pig : 92%, Rabbit : 84%
Characteristics This is a rabbit polyclonal antibody against HMG20A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HMG20A
Background HMG20A plays a role in neuronal differentiation as chromatin-associated protein. It overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. The protein also act as inhibitor of HMG20B. It involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4.
Molecular Weight 40kDa
Gene ID 10363
NCBI Accession NP_060670, NM_018200
UniProt Q9NP66
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HMG20A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "High-Mobility Group 20A (HMG20A)", type "Antibodies"
Hosts (16), (8), (7)
Reactivities (30), (11), (10), (6), (5), (2), (1)
Applications (19), (14), (7), (5), (4), (3), (1)
Epitopes (7), (3), (2), (2), (1), (1)
Beacon