Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) antibody

Antigen

Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2)

Synonyms SMNC, BCD541, MGC5208, C-BCD541, FLJ76644, MGC20996, SMN2, SMN1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405311
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name SIP1 / GEMIN2
Gene ID SIP1
UniProt O14893-2
Immunogen The immunogen for anti-SIP1 antibody: synthetic peptide directed towards the middle region of human SIP1
Sequence HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYF DQRDLADEPS
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SIP1 antibody concentration is 1 mg/ml.
Description Part of the core SMN complex which plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.
Characteristics Antigen Size: 265 amino acids
Molecular Weight 30kDa

Application Details

Application Notes WB Suggested Anti-SIP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Gregory, Bert, Paterson et al.: "The miR-200 family and miR-205 regulate epithelial to mesenchymal transition by targeting ZEB1 and SIP1." in: Nature cell biology, Vol. 10, Issue 5, pp. 593-601, 2008 (PubMed).

Alternatives

Alternatives for antigen "Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2)", type "Antibodies"
Hosts Rabbit (22), Mouse (4)
Reactivities Human (26), Mouse (Murine) (21), Rat (Rattus) (20), Chicken (18), Dog (Canine) (18), Horse (Equine) (18), Xenopus laevis (4)
Applications Immunofluorescence (IF) (21), Western Blotting (WB) (11), ELISA (10), Immunocytochemistry (ICC) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunoprecipitation (IP) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes N-Term (1)