Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) antibody

Antigen: Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1)

Synonyms: PABP, ePAB, Pabp1, PabpI, Pabpl1, PAB1, PABP1, PABPC2, PABPL1, Pabp, MGC91496, pab-2, fi20g03, zgc:55855, wu:fi20g03, CH1073-323J3.1, pabpc1-a, pabpc1, MGC53109, pab1, pabp, pabp1, pabpc2, MGC89198

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN405319

Additional Information

Alternative name: PABPC1

Gene ID: PABPC1

UniProt: P11940

Immunogen: The immunogen for anti-PABPC1 antibody: synthetic peptide directed towards the middle region of human PABPC1

Sequence: LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPAS SQVPRVMSTQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PABPC1 antibody concentration is 1 mg/ml.

Description: The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation. In humans, the PABPs comprise a small nuclear isoform and a conserved gene family that displays at least 3 functional proteins: PABP1 (PABPC1), inducible PABP (iPABP, or PABPC4, MIM 603407), and PABP3 (PABPC3, MIM 604680). In addition, there are at least 4 pseudogenes, PABPCP1 to PABPCP4.The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation. In humans, the PABPs comprise a small nuclear isoform and a conserved gene family that displays at least 3 functional proteins: PABP1 (PABPC1), inducible PABP (iPABP, or PABPC4, MIM 603407), and PABP3 (PABPC3, MIM 604680). In addition, there are at least 4 pseudogenes, PABPCP1 to PABPCP4.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 636 amino acids

Molecular Weight: 71kDa

Application Details

Application Notes: WB Suggested Anti-PABPC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PABPC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Publications

Product: Rivera, Lloyd: "Modulation of enteroviral proteinase cleavage of poly(A)-binding protein (PABP) by conformation and PABP-associated factors." in: Virology, Vol. 375, Issue 1, pp. 59-72, 2008 (PubMed).