Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Creatine Kinase, Muscle (CKM) antibody

Antigen

Creatine Kinase, Muscle (CKM)

Synonyms CKMM, M-CK, MCK, Ckmm, CKM, ckm, MGC53368, ckmm, m-ck, MGC75682
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Pig (Porcine), Zebrafish, Rabbit, Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405408
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name CKMM
Gene ID CKM
UniProt P06732
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM
Sequence VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLN HENLKGGDDL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rabbit, Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CKM antibody concentration is 1 mg/ml.
Description CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. CKM is a member of the ATP: guanido phosphotransferase protein family.The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 381 amino acids
Molecular Weight 43kDa

Application Details

Application Notes WB Suggested Anti-CKM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Yamin, Amir, Sagiv et al.: "ACE ID genotype affects blood creatine kinase response to eccentric exercise." in: Journal of applied physiology (Bethesda, Md. : 1985), Vol. 103, Issue 6, pp. 2057-61, 2007 (PubMed).

Alternatives

Alternatives for antigen "Creatine Kinase, Muscle (CKM)", type "Antibodies"
Hosts Rabbit (48), Mouse (35), Goat (22)
Reactivities Human (79), Rat (Rattus) (22), Mouse (Murine) (18), Cow (Bovine) (7), Rabbit (6), Pig (Porcine) (5), Dog (Canine) (2), Cat (Feline) (1), Chicken (1)
Applications ELISA (76), Western Blotting (WB) (52), Immunohistochemistry (IHC) (26), Immunofluorescence (IF) (10), Immunoprecipitation (IP) (7), Enzyme Immunoassay (EIA) (4), Lateral Flow (LF) (3), Flow Cytometry (FACS) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Radioimmunoassay (RIA) (2), Immunoassay (IA) (1)
Conjugates Biotin (5), FITC (1), HRP (1)
Epitopes N-Term (8), C-Term (3), Internal Region (1), Subunit B (1)