ATG4 Autophagy Related 4 Homolog A (S. Cerevisiae) (ATG4A) antibody

Antigen: ATG4 Autophagy Related 4 Homolog A (S. Cerevisiae) (ATG4A)

Synonyms: APG4A, AUTL2, Apg4a, Autl2, Atg4al, AI627006, AV169859, MGC107179, Aut2a, apg4a, autl2, MGC82614, zgc:111958, F6E13.27, DKFZp459N0219

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN405496

Additional Information

Alternative name: Autophagin-2

Gene ID: ATG4A

UniProt: Q8WYN0

Immunogen: The immunogen for anti-ATG4A antibody: synthetic peptide directed towards the N terminal of human ATG4A

Sequence: DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEY QRILQCFLDR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ATG4A antibody concentration is 1 mg/ml.

Description: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. ATG4A is a member of the autophagin protein family. ATG4A is also designated as a member of the C-54 family of cysteine proteases.Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Transcript variants that encode distinct isoforms have been identified.

Characteristics: Antigen Size: 398 amino acids

Molecular Weight: 45kDa

Application Details

Application Notes: WB Suggested Anti-ATG4A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ATG4A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Publications

Product: Scherz-Shouval, Shvets, Fass et al.: "Reactive oxygen species are essential for autophagy and specifically regulate the activity of Atg4." in: The EMBO journal, Vol. 26, Issue 7, pp. 1749-60, 2007 (PubMed).