Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405542

Ring Finger Protein 20 (RNF20) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BRE1, BRE1A, hBRE1, 4833430L21Rik, AW540162, C79397, mKIAA4116
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405542
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RNF20 antibody: synthetic peptide directed towards the N terminal of human RNF20
Sequence LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRE RGEGQEPAFS
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against RNF20. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RNF20
Background RNF20 shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is an ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3. The protein encoded by this gene shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is a ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3.
Molecular Weight 114kDa
Gene ID 56254
NCBI Accession NP_062538, NM_019592
UniProt Q5VTR2
Research Area Proteolysis / Ubiquitin, Chromatin and Nuclear Signaling, Ion Channels
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RNF20 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Barber, McManus, Yuen et al.: "Chromatid cohesion defects may underlie chromosome instability in human colorectal cancers." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 9, pp. 3443-8, 2008 (PubMed).

Alternatives for antigen "Ring Finger Protein 20 (RNF20)", type "Antibodies"
Hosts (30), (5)
Reactivities (33), (16), (15), (13), (13), (13), (12)
Applications (25), (12), (10), (5), (4), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (2), (2), (1), (1), (1), (1), (1)
Beacon