Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1) antibody

Antigen

HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1)

Synonyms BC025474, KIAA1320, 1700042J16Rik, A730034A22Rik, hace1, MGC81769, HACE1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Chicken, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405544
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name HACE1
Gene ID HACE1
UniProt Q8IYU2
Immunogen The immunogen for anti-HACE1 antibody: synthetic peptide directed towards the middle region of human HACE1
Sequence DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLL LQFVTGSSRV
Cross-Reactivity Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-HACE1 antibody concentration is 1 mg/ml.
Description HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation.
Characteristics Antigen Size: 909 amino acids
Molecular Weight 102kDa

Application Details

Application Notes WB Suggested Anti-HACE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Zhang, Anglesio, OSullivan et al.: "The E3 ligase HACE1 is a critical chromosome 6q21 tumor suppressor involved in multiple cancers." in: Nature medicine, Vol. 13, Issue 9, pp. 1060-9, 2007 (PubMed).

Alternatives

Alternatives for antigen "HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1)", type "Antibodies"
Hosts Rabbit (22), Mouse (3)
Reactivities Human (24), Mouse (Murine) (20), Rat (Rattus) (19), Chicken (18), Cow (Bovine) (18), Dog (Canine) (18), Horse (Equine) (18), Pig (Porcine) (18), Xenopus laevis (1)
Applications Immunofluorescence (IF) (18), Western Blotting (WB) (10), ELISA (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1), Immunoprecipitation (IP) (1)
Conjugates Biotin (2), FITC (2), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (2)