Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405549

LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4932412G04Rik, 5730439E01Rik, A830039N02Rik, AU023707, Rnf127, RNF127, RGD1565451
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405549
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LONRF3 antibody: synthetic peptide directed towards the middle region of human LONRF3
Sequence LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADI EYIEDQKVQG
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Pig : 92%, Rabbit : 92%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against LONRF3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LONRF3
Background LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear. The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.
Molecular Weight 84kDa
Gene ID 79836
NCBI Accession NP_001027026, NM_001031855
UniProt Q496Y0
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Metabolism, Amino Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LONRF3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3)", type "Antibodies"
Hosts (9), (3)
Reactivities (10), (1), (1)
Applications (12), (5)
Epitopes (3), (3), (2), (2), (1)
Beacon