Did you know that you can buy products from over 140 different suppliers from us?

LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3) (Middle Region) antibody

Details for Product No. ABIN405549
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RNF127, 4932412G04Rik, 5730439E01Rik, A830039N02Rik, AU023707, Rnf127, RGD1565451
Epitope
Middle Region
(7), (6), (4), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(14), (1), (1)
Host
Rabbit
(13), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (9), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405549
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LONRF3
Sequence LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADI EYIEDQKVQG
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Guinea pig : 90 %, Horse : 90 %, Pig : 90 %, Rabbit : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against LONRF3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LONRF3
Background LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear. The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.
Molecular Weight 84 kDa
Gene ID 79836
NCBI Accession NM_001031855, NP_001027026
UniProt Q496Y0
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Metabolism, Amino Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 759 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3) (Middle Region) antibody WB Suggested Anti-LONRF3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Validation Images
back to top