Did you know that you can buy products from over 140 different suppliers from us?

Ubiquitin Protein Ligase E3B (UBE3B) (Middle Region) antibody

Details for Product No. ABIN405556
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BPIDS, AI449831, AU020130, si:dkey-189p24.3
Epitope
Middle Region
(1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
(7)
Host
Rabbit
(7), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405556
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human UBE3B
Sequence VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERL YPSPTSYIHE
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against UBE3B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name UBE3B
Background The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE3B is a member of the E3 ubiquitin-conjugating enzyme family. UBE3B may interact with other proteins and play a role in stress response.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E3 ubiquitin-conjugating enzyme family. The encoded protein may interact with other proteins and play a role in stress response. Alternatively spliced transcript variants encoding the same protein isoform have been identified for this gene.
Molecular Weight 123 kDa
Gene ID 89910
NCBI Accession NM_130466, NP_569733
UniProt Q7Z3V4
Research Area Cell Cycle, Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1068 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ubiquitin Protein Ligase E3B (UBE3B) (Middle Region) antibody WB Suggested Anti-UBE3B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Product cited in: Szafranski, Schindler, Taudien et al.: "Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns." in: Genome biology, Vol. 8, Issue 8, pp. R154, 2008 (PubMed).

Hosts (7), (1)
Reactivities (7)
Applications (8), (4), (1)
Epitopes (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405556
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top