Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405556

Ubiquitin Protein Ligase E3B (UBE3B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BPIDS, AI449831, AU020130, si:dkey-189p24.3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405556
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UBE3B antibody: synthetic peptide directed towards the middle region of human UBE3B
Sequence VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERL YPSPTSYIHE
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against UBE3B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name UBE3B
Background The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE3B is a member of the E3 ubiquitin-conjugating enzyme family. UBE3B may interact with other proteins and play a role in stress response.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E3 ubiquitin-conjugating enzyme family. The encoded protein may interact with other proteins and play a role in stress response. Alternatively spliced transcript variants encoding the same protein isoform have been identified for this gene.
Molecular Weight 123kDa
Gene ID 89910
NCBI Accession NP_569733, NM_130466
UniProt Q7Z3V4
Research Area Cell Cycle, Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UBE3B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Szafranski, Schindler, Taudien et al.: "Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns." in: Genome biology, Vol. 8, Issue 8, pp. R154, 2008 (PubMed).

Alternatives for antigen "Ubiquitin Protein Ligase E3B (UBE3B)", type "Antibodies"
Hosts (7), (1)
Reactivities (7)
Applications (8), (6)
Epitopes (2), (1)
Beacon