Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405560

Ring Finger Protein 185 (RNF185) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700022N24Rik, AL033296, zgc:73070, xrnf185
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Dog (Canine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405560
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RNF185 antibody: synthetic peptide directed towards the middle region of human RNF185
Sequence QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQ RPEPENRGGF
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Pig : 100%, African clawed frog : 92%
Characteristics This is a rabbit polyclonal antibody against RNF185. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RNF185
Background RNF185 is a multi-pass membrane protein. It contains 1 RING-type zinc finger.The exact function of RNF185 remains unknown.
Molecular Weight 20kDa
Gene ID 91445
NCBI Accession NP_689480, NM_152267
UniProt Q96GF1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RNF185 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Ring Finger Protein 185 (RNF185)", type "Antibodies"
Hosts (17), (2)
Reactivities (17), (14), (12), (12), (2)
Applications (10), (9), (5), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1)
Beacon