Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ring Finger Protein 185 (RNF185) antibody

Antigen

Ring Finger Protein 185 (RNF185)

Synonyms FLJ38628
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Chicken, Xenopus laevis, Dog (Canine), Pig (Porcine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405560
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name RNF185
Gene ID RNF185
UniProt Q96GF1
Immunogen The immunogen for anti-RNF185 antibody: synthetic peptide directed towards the middle region of human RNF185
Sequence QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQ RPEPENRGGF
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RNF185 antibody concentration is 1 mg/ml.
Description RNF185 is a multi-pass membrane protein. It contains 1 RING-type zinc finger.The exact function of RNF185 remains unknown.
Characteristics Antigen Size: 192 amino acids
Molecular Weight 20kDa

Application Details

Application Notes WB Suggested Anti-RNF185 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives

Alternatives for antigen "Ring Finger Protein 185 (RNF185)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (21), Mouse (Murine) (19), Cow (Bovine) (18), Pig (Porcine) (18), Rat (Rattus) (18), Zebrafish (Danio rerio) (18), Hamster (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (7), ELISA (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Flow Cytometry (FACS) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes Center (1), Internal Region (1), Internal Region,AA 91-121 (1)