Did you know that you can buy products from over 140 different suppliers from us?

RING Finger Protein 207 (RNF207) (N-Term) antibody

Details for Product No. ABIN405571
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C1orf188, D330010C22Rik, Gm143
Epitope
N-Term
(7), (6), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(10)
Host
Rabbit
(9), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (8), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405571
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RNF207
Sequence CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGL PPVDRLLQFL
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Horse : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against RNF207. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RNF207
Background RNF207 contains 1 B box-type zinc finger and 1 RING-type zinc finger. The function of the RNF207 protein remains unknown.
Molecular Weight 71 kDa
Gene ID 388591
NCBI Accession NM_207396, NP_997279
UniProt Q6ZRF8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 634 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RING Finger Protein 207 (RNF207) (N-Term) antibody WB Suggested Anti-RNF207 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Product cited in: Wistow, Bernstein, Wyatt et al.: "Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants." in: Molecular vision, Vol. 8, pp. 171-84, 2002 (PubMed).

Background publications Ko, Kay: "Differential interaction of molecular chaperones with procollagen I and type IV collagen in corneal endothelial cells." in: Molecular vision, Vol. 8, pp. 1-9, 2002 (PubMed).

Validation Images
back to top