Did you know that you can buy products from over 140 different suppliers from us?

Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6) (Middle Region) antibody

Details for Product No. ABIN405592
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms zgc:153783, ACSVL2, FACVL2, FATP6, VLCS-H1, 4732438L20Rik
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Cow (Bovine), Human
(13), (12), (12), (12)
Host
Rabbit
(13), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (5), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405592
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SLC27A6
Sequence KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTA HDIVYITLPL
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against SLC27A6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SLC27A6
Background SLC27A6 is a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.This gene encodes a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Molecular Weight 70 kDa
Gene ID 28965
NCBI Accession NM_001017372, NP_001017372
UniProt Q9Y2P4
Research Area Cardiovascular, Fatty Acids, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 619 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6) (Middle Region) antibody WB Suggested Anti-SLC27A6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6) (Middle Region) antibody (2) Rabbit Anti-SLC27A6 Antibody ,Paraffin Embedded Tissue: Human Pineal Tissue
Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:000
Magnification: 00X
Exposure Time: 0.5 - 2.0 sec
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Validation Images
back to top