Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405686

Tectonic Family Member 3 (TCTN3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1305166, C10orf61, JBTS18, OFD4, TECT3, Tect3, AI197391, 4930521E07Rik, CVAL, VALOP, tectonic-3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405686
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCTN3 antibody: synthetic peptide directed towards the middle region of human TCTN3
Sequence LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTT CTRFFKNLAS
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against TCTN3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TCTN3
Background TCTN3 may be involved in apoptosis regulation.
Molecular Weight 64kDa
Gene ID 26123
NCBI Accession NP_056446, NM_015631
UniProt Q6NUS6
Research Area Apoptosis/Necrosis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TCTN3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Reiter, Skarnes: "Tectonic, a novel regulator of the Hedgehog pathway required for both activation and inhibition." in: Genes & development, Vol. 20, Issue 1, pp. 22-7, 2006 (PubMed).

Alternatives for antigen "Tectonic Family Member 3 (TCTN3)", type "Antibodies"
Hosts (35)
Reactivities (34), (30), (30), (17), (17), (17)
Applications (19), (15), (15), (13), (10), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (25), (1)
Beacon