Did you know that you can buy products from over 140 different suppliers from us?

Tectonic Family Member 3 (TCTN3) (Middle Region) antibody

Details for Product No. ABIN405686
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1305166, C10orf61, JBTS18, OFD4, TECT3, Tect3, AI197391, 4930521E07Rik, CVAL, VALOP, tectonic-3
Epitope
Middle Region
(25), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(34), (32), (31), (17), (17), (17)
Host
Rabbit
(36)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (15), (14), (14), (14), (3), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405686
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TCTN3
Sequence LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTT CTRFFKNLAS
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against TCTN3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TCTN3
Background TCTN3 may be involved in apoptosis regulation.
Molecular Weight 64 kDa
Gene ID 26123
NCBI Accession NM_015631, NP_056446
UniProt Q6NUS6
Research Area Apoptosis/Necrosis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 607 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tectonic Family Member 3 (TCTN3) (Middle Region) antibody WB Suggested Anti-TCTN3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Background publications Reiter, Skarnes: "Tectonic, a novel regulator of the Hedgehog pathway required for both activation and inhibition." in: Genes & development, Vol. 20, Issue 1, pp. 22-7, 2006 (PubMed).

Hosts (36)
Reactivities (34), (32), (31), (17), (17), (17)
Applications (20), (15), (14), (14), (14), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (25), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405686
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top