Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405687

Transmembrane Protein 93 (TMEM93) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TMEM93, 0610009E20Rik, 0610025L18Rik, Tmem93, RGD1309231, tmem93, wu:fb02d05, zgc:56250, zgc:77320
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405687
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM93 antibody: synthetic peptide directed towards the N terminal of human TMEM93
Sequence AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATA GILGLTGLYG
Predicted Reactivity Mouse : 100%, Rat : 100%, African clawed frog : 92%, Chicken : 92%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against TMEM93. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM93
Background TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.
Molecular Weight 12kDa
Gene ID 83460
NCBI Accession NP_112588, NM_031298
UniProt Q9BV81
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM93 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Transmembrane Protein 93 (TMEM93)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2), (1)
Epitopes (1)
Beacon