Transmembrane Protein 93 (TMEM93) (N-Term) antibody

Details for Product No. ABIN405687
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TMEM93, 0610009E20Rik, 0610025L18Rik, Tmem93, RGD1309231, tmem93, wu:fb02d05, zgc:56250, zgc:77320
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Catalog no. ABIN405687
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TMEM93
Sequence AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATA GILGLTGLYG
Predicted Reactivity Mouse : 100 %, Rat : 100 %, African clawed frog : 90 %, Chicken : 90 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against TMEM93. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMEM93
Background TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.
Molecular Weight 12 kDa
Gene ID 83460
NCBI Accession NM_031298, NP_112588
UniProt Q9BV81
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 110 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transmembrane Protein 93 (TMEM93) (N-Term) antibody WB Suggested Anti-TMEM93 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top