Coiled-Coil Domain Containing 90A (CCDC90A) (Middle Region) antibody

Details for Product No. ABIN405700
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C6orf79, CCDC90A, 6230416A05Rik, AU015498, AV136929, AW554392, C88263, Ccdc90a, RGD1307673, ccdc90a
Epitope
Middle Region
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 3 references available
Catalog no. ABIN405700
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CCDC90A
Sequence ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEK KLLELRTEIV
Predicted Reactivity Guinea pig : 92 %, Rat : 92 %, Chicken : 82 %, Dog : 82 %, Horse : 82 %, Bovine : 72 %
Characteristics This is a rabbit polyclonal antibody against CCDC90A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CCDC90A
Background Essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism.
Molecular Weight 40 kDa
Gene ID 63933
NCBI Accession NM_001031713, NP_001026883
UniProt Q96AQ8
Research Area Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 359 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Coiled-Coil Domain Containing 90A (CCDC90A) (Middle Region) antibody WB Suggested Anti-CCDC90A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain
Product cited in: Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Mallilankaraman, Cárdenas, Doonan et al.: "MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism." in: Nature cell biology, Vol. 14, Issue 12, pp. 1336-43, 2012 (PubMed).

Hosts (1)
Applications (1)
back to top