Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405700

Coiled-Coil Domain Containing 90A (CCDC90A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C6orf79, CCDC90A, 6230416A05Rik, AU015498, AV136929, AW554392, C88263, Ccdc90a, RGD1307673, ccdc90a
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 3 references available
Catalog no. ABIN405700
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCDC90A antibody: synthetic peptide directed towards the middle region of human CCDC90A
Sequence ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEK KLLELRTEIV
Predicted Reactivity Guinea pig : 92%, Rat : 92%, Chicken : 85%, Dog : 85%, Horse : 85%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against CCDC90A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CCDC90A
Background Essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism.
Molecular Weight 40kDa
Gene ID 63933
NCBI Accession NP_001026883, NM_001031713
UniProt Q96AQ8
Research Area Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCDC90A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Mallilankaraman, Cárdenas, Doonan et al.: "MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism." in: Nature cell biology, Vol. 14, Issue 12, pp. 1336-43, 2012 (PubMed).

Alternatives for antigen "Coiled-Coil Domain Containing 90A (CCDC90A)", type "Antibodies"
Hosts (3)
Reactivities (1)
Applications (2), (1), (1)
Epitopes (1)
Beacon