Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405723

Down Syndrome Cell Adhesion Molecule (DSCAM) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CHD2-42, CHD2-52, 4932410A21Rik, Dscam, DSCAM, chd2-42, chd2-52, dscam, GB15141, 43Bc, CG17800, CT39257, DScam, DmDscam, Dm_2R:13612, Dmel\\CG17800, Dscam-hv, Dscam1, FBgn0033159, Neu1, dScam, l(2)055 ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405723
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DSCAM antibody: synthetic peptide directed towards the middle region of human DSCAM
Sequence MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGL TTNEGLKMLV
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Chicken : 92%, Guinea pig : 92%, African clawed frog : 85%
Characteristics This is a rabbit polyclonal antibody against DSCAM. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DSCAM
Background DSCAM is a cell adhesion molecule that can mediate cation-independent homophilic binding activity. DSCAM could be involved in nervous system development.
Molecular Weight 220kDa
Gene ID 1826
NCBI Accession NP_001380, NM_001389
UniProt O60469
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DSCAM antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives for antigen "Down Syndrome Cell Adhesion Molecule (DSCAM)", type "Antibodies"
Hosts (19), (6), (4)
Reactivities (26), (20), (19), (19), (18), (17)
Applications (15), (12), (12), (10), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (1), (1)
Beacon