Did you know that you can buy products from over 140 different suppliers from us?

Down Syndrome Cell Adhesion Molecule (DSCAM) (Middle Region) antibody

Details for Product No. ABIN405723
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CHD2-42, CHD2-52, 4932410A21Rik, Dscam, DSCAM, chd2-42, chd2-52, dscam, GB15141, 43Bc, CG17800, CT39257, DScam, DmDscam, Dm_2R:13612, Dmel\\CG17800, Dscam-hv, Dscam1, FBgn0033159, Neu1, dScam, l(2)055 ... show more
CHD2-42, CHD2-52, 4932410A21Rik, Dscam, DSCAM, chd2-42, chd2-52, dscam, GB15141, 43Bc, CG17800, CT39257, DScam, DmDscam, Dm_2R:13612, Dmel\\CG17800, Dscam-hv, Dscam1, FBgn0033159, Neu1, dScam, l(2)05518, l(2)43Bc, p270 show less
Epitope
Middle Region
(4), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Human
(25), (20), (19), (19), (18), (17)
Host
Rabbit
(19), (5), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB), Immunoprecipitation (IP)
(15), (14), (11), (10), (4), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405723
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DSCAM
Sequence MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGL TTNEGLKMLV
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Chicken : 90 %, Guinea pig : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against DSCAM. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DSCAM
Background DSCAM is a cell adhesion molecule that can mediate cation-independent homophilic binding activity. DSCAM could be involved in nervous system development.
Molecular Weight 220 kDa
Gene ID 1826
NCBI Accession NM_001389, NP_001380
UniProt O60469
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 2012 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Down Syndrome Cell Adhesion Molecule (DSCAM) (Middle Region) antibody WB Suggested Anti-DSCAM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Hosts (19), (5), (4)
Reactivities (25), (20), (19), (19), (18), (17)
Applications (15), (14), (11), (10), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405723
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top