Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405772

Receptor-Interacting Serine-threonine Kinase 4 (RIPK4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANKK2, ANKRD3, DIK, NKRD3, PKK, PPS2, RIP4, DIk, Ankrd3, AI552420, 2310069J12Rik, dik, pkk, rip4, ankk2, ankrd3, ripk4a, MGC53701, MGC132134, zgc:55705, wu:fj80b10, ripk4b, RIPK4
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405772
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RIPK4 antibody: synthetic peptide directed towards the middle region of human RIPK4
Sequence GLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGP AATLLRRSKT
Predicted Reactivity Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Horse : 92%
Characteristics This is a rabbit polyclonal antibody against RIPK4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RIPK4
Background RIPK4 is a serine/threonine protein kinase that interacts with protein kinase C-delta. The protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation.The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation.
Molecular Weight 86kDa
Gene ID 54101
NCBI Accession NP_065690, NM_020639
UniProt Q9H4D1
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RIPK4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kim, Oleksyn, Rossi et al.: "Protein kinase C-associated kinase is required for NF-kappaB signaling and survival in diffuse large B-cell lymphoma cells." in: Blood, Vol. 111, Issue 3, pp. 1644-53, 2008 (PubMed).

Alternatives for antigen "Receptor-Interacting Serine-threonine Kinase 4 (RIPK4)", type "Antibodies"
Hosts (13), (6), (3)
Reactivities (21), (10), (2)
Applications (19), (13), (7), (2)
Epitopes (5), (5), (4), (2), (2), (2), (2), (1), (1)
Beacon