Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

RIPK4 antibody (Receptor-Interacting Serine-threonine Kinase 4) (AA 675-784) Primary Antibody

RIPK4 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 4H5 unconjugated
Catalog No. ABIN527013
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    RIPK4
    Binding Specificity
    • 10
    • 9
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    AA 675-784
    Reactivity
    • 40
    • 18
    • 8
    • 4
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 35
    • 5
    • 1
    Mouse
    Clonality
    • 36
    • 5
    Monoclonal
    Conjugate
    • 20
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This RIPK4 antibody is un-conjugated
    Application
    • 34
    • 26
    • 25
    • 3
    • 2
    • 2
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant RIPK4.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: RIPK4 (NP_065690, 675 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT

    Clone
    4H5
    Isotype
    IgG3 kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    RIPK4
    Alternative Name
    RIPK4 (RIPK4 Antibody Abstract)
    Synonyms
    dik, pkk, rip4, ankk2, ankrd3, ripk4a, MGC53701, MGC132134, zgc:55705, wu:fj80b10, ripk4b, RIPK4, ANKK2, ANKRD3, DIK, NKRD3, PKK, PPS2, RIP4, 2310069J12Rik, AI552420, Ankrd3, DIk, receptor interacting serine/threonine kinase 4 L homeolog, receptor-interacting serine-threonine kinase 4, receptor interacting serine/threonine kinase 4, receptor interacting serine/threonine kinase 4 S homeolog, ripk4.L, ripk4, RIPK4, ripk4.S, Ripk4
    Background
    Full Gene Name: receptor-interacting serine-threonine kinase 4
    Synonyms: ANKK2,ANKRD3,DIK,MGC129992,MGC129993,PKK,RIP4
    Gene ID
    54101
    NCBI Accession
    NP_065690, NM_020639
You are here:
help Support