Src Kinase Associated phosphoprotein 1 (SKAP1) (N-Term) antibody

Details for Product No. ABIN405786
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms SCAP1, SKAP55, 1700091G21Rik, Scap1, Skap-55, Skap55
Epitope
N-Term
(2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(29), (15), (3)
Host
Rabbit
(23), (6), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (11), (10), (6), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN405786
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SKAP1
Sequence RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLG LSLTSDAPFL
Predicted Reactivity Human : 100 %, Mouse : 80 %, Rabbit : 80 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against SKAP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SKAP1
Background SKAP1 Is a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.
Molecular Weight 41 kDa
Gene ID 8631
NCBI Accession NM_003726, NP_003717
UniProt Q86WV1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 359 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Kosco, Cerignoli, Williams et al.: "SKAP55 modulates T cell antigen receptor-induced activation of the Ras-Erk-AP1 pathway by binding RasGRP1." in: Molecular immunology, Vol. 45, Issue 2, pp. 510-22, 2007 (PubMed).

Hosts (23), (6), (1)
Reactivities (29), (15), (3)
Applications (21), (11), (10), (6), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1)
back to top