Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405786

Src Kinase Associated phosphoprotein 1 (SKAP1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SCAP1, SKAP55, 1700091G21Rik, Scap1, Skap-55, Skap55
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405786
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SKAP1 antibody: synthetic peptide directed towards the N terminal of human SKAP1
Sequence RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLG LSLTSDAPFL
Predicted Reactivity Human : 100%, Mouse : 85%, Rabbit : 85%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against SKAP1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SKAP1
Background SKAP1 Is a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.
Molecular Weight 41kDa
Gene ID 8631
NCBI Accession NP_003717, NM_003726
UniProt Q86WV1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SKAP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kosco, Cerignoli, Williams et al.: "SKAP55 modulates T cell antigen receptor-induced activation of the Ras-Erk-AP1 pathway by binding RasGRP1." in: Molecular immunology, Vol. 45, Issue 2, pp. 510-22, 2007 (PubMed).

Alternatives for antigen "Src Kinase Associated phosphoprotein 1 (SKAP1)", type "Antibodies"
Hosts (25), (6), (1)
Reactivities (31), (14), (2)
Applications (23), (13), (10), (6), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (1), (1), (1)
Beacon