Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3) antibody

Antigen: Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3)

Synonyms: ACS3, FACL3, PRO2194, Acs3, Facl3, C85929, Pro2194, 2610510B12Rik, ACSL3, fb34c03, im:7155129, wu:fa07a08, wu:fb34c03, si:dkey-20f20.5, si:dkeyp-109h9.2, DKFZp459J0124

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN405824

Additional Information

Alternative name: ACSL3

Gene ID: ACSL3

UniProt: O95573

Immunogen: The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3

Sequence: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNE EDEVQPNGKI

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ACSL3 antibody concentration is 1 mg/ml.

Description: ACSL3 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.

Characteristics: Antigen Size: 720 amino acids

Molecular Weight: 80kDa

Application Details

Application Notes: WB Suggested Anti-ACSL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cardiovascular, Fatty Acids, Metabolism

Restrictions: For Research Use only

Images

WB Suggested Anti-ACSL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Publications

Product: Yao, Ye: "Long chain acyl-CoA synthetase 3-mediated phosphatidylcholine synthesis is required for assembly of very low density lipoproteins in human hepatoma Huh7 cells." in: The Journal of biological chemistry, Vol. 283, Issue 2, pp. 849-54, 2008 (PubMed).