Wingless-Type MMTV Integration Site Family, Member 6 (WNT6) (Middle Region) antibody

Details for Product No. ABIN405845
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AA409270, Wnt-6, Xwnt-6, wnt-6, wnt6-A, xWnt6, WNT6, si:dkey-31m21.2, Wnt6
Epitope
Middle Region
(5), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(27), (15), (15), (1)
Host
Rabbit
(29), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (10), (7), (5), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN405845
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human WNT6
Sequence ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSP DFCAPNRRTG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against WNT6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name WNT6
Background The WNT family consists of several secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT6 is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The WNT6 protein overexpression may play key roles in carcinogenesis. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The gene overexpression may play key roles in carcinogenesis. This gene and the WNT10A gene are clustered in the chromosome 2q35 region. The protein encoded by this gene is 97 % identical to the mouse Wnt6 protein at the amino acid level.
Molecular Weight 37 kDa
Gene ID 7475
NCBI Accession NM_006522, NP_006513
UniProt Q9Y6F9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 365 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Wingless-Type MMTV Integration Site Family, Member 6 (WNT6) (Middle Region) antibody WB Suggested Anti-WNT6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Adaimy, Chouery, Megarbane et al.: "Mutation in WNT10A is associated with an autosomal recessive ectodermal dysplasia: the odonto-onycho-dermal dysplasia." in: American journal of human genetics, Vol. 81, Issue 4, pp. 821-8, 2007 (PubMed).

Hosts (29), (1), (1)
Reactivities (27), (15), (15), (1)
Applications (18), (10), (7), (5), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (2), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top