Did you know that you can buy products from over 140 different suppliers from us?

Rhomboid 5 Homolog 1 (Drosophila) (RHBDF1) (N-Term) antibody

Details for Product No. ABIN406075
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms zgc:91984, C16orf8, Dist1, EGFR-RS, gene-89, gene-90, hDist1, C16ORF8, Dist, Egfr-rs, mKIAA4242
Epitope
N-Term
(1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406075
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RHBDF1
Sequence KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKE GAAAPQPKVR
Predicted Reactivity Dog : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against RHBDF1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RHBDF1
Background RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.
Molecular Weight 97 kDa
Gene ID 64285
NCBI Accession NM_022450, NP_071895
UniProt Q96CC6
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 855 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Rhomboid 5 Homolog 1 (Drosophila) (RHBDF1) (N-Term) antibody WB Suggested Anti-RHBDF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406075
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top