RHBDF1 antibody

Catalog No. ABIN635205

Product Details anti-RHBDF1 Antibody

Target: RHBDF1 (Rhomboid 5 Homolog 1 (RHBDF1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHBDF1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RHBDF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHBDF1 Blocking Peptide, catalog no. 33R-4310, is also available for use as a blocking control in assays to test for specificity of this RHBDF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHBDF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHBDF1

Target: RHBDF1 (Rhomboid 5 Homolog 1 (RHBDF1))

Alternative Name: RHBDF1 (RHBDF1 Products)

Synonyms: zgc:91984 antibody, C16orf8 antibody, Dist1 antibody, EGFR-RS antibody, gene-89 antibody, gene-90 antibody, hDist1 antibody, C16ORF8 antibody, Dist antibody, Egfr-rs antibody, mKIAA4242 antibody, rhomboid 5 homolog 1 antibody, rhomboid 5 homolog 1a (Drosophila) antibody, RHBDF1 antibody, rhbdf1 antibody, rhbdf1a antibody, Rhbdf1 antibody

Background: RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Growth Factor Binding