Did you know that you can buy products from over 140 different suppliers from us?

Cadherin 24 (CDH24) (N-Term) antibody

Details for Product No. ABIN406076
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CDH11L, 1700040A22Rik, ENSMUSG00000022188, RGD1560161
Epitope
N-Term
(3), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(7), (6)
Host
Rabbit
(8)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (6), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406076
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CDH24
Sequence NPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNS AKLVYTVLDG
Predicted Reactivity Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against CDH24. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CDH24
Background Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells, cadherins may thus contribute to the sorting of heterogeneous cell types. Cadherin-24 mediate strong cell-cell adhesion.
Molecular Weight 88 kDa
Gene ID 64403
NCBI Accession NM_022478, NP_071923
UniProt Q86UP0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 819 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406076
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top