Cadherin 24 antibody (N-Term)

Catalog No. ABIN634707

Product Details anti-Cadherin 24 Antibody

Target: Cadherin 24 (CDH24)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cadherin 24 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CDH24 antibody was raised against the N terminal of CDH24

Purification: Affinity purified

Immunogen: CDH24 antibody was raised using the N terminal of CDH24 corresponding to a region with amino acids NPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTVLDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDH24 Blocking Peptide, catalog no. 33R-6825, is also available for use as a blocking control in assays to test for specificity of this CDH24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cadherin 24

Target: Cadherin 24 (CDH24)

Alternative Name: CDH24 (CDH24 Products)

Synonyms: CDH11L antibody, 1700040A22Rik antibody, ENSMUSG00000022188 antibody, RGD1560161 antibody, cdh24 antibody, cadherin 24 antibody, cadherin-like 24 antibody, cadherin-24 antibody, CDH24 antibody, Cdh24 antibody, LOC100007192 antibody

Background: Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells, cadherins may thus contribute to the sorting of heterogeneous cell types. Cadherin-24 mediate strong cell-cell adhesion.

Molecular Weight: 88 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization