Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406079

Metallophosphoesterase 1 (MPPE1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PGAP5, A530095G11, zgc:112219, pgap5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406079
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MPPE1 antibody: synthetic peptide directed towards the N terminal of human MPPE1
Sequence WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHP SHVQLKVVAG
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Horse : 92%, Rat : 92%, Zebrafish : 92%, African clawed frog : 78%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against MPPE1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MPPE1
Background The specific function of MPPE1 is not yet known.
Molecular Weight 40kDa
Gene ID 65258
NCBI Accession NP_075563, NM_023075
UniProt Q53F39
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MPPE1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Fortna, Kim, MacLaren et al.: "Lineage-specific gene duplication and loss in human and great ape evolution." in: PLoS biology, Vol. 2, Issue 7, pp. E207, 2004 (PubMed).

Alternatives for antigen "Metallophosphoesterase 1 (MPPE1)", type "Antibodies"
Hosts (5)
Reactivities (4)
Applications (5), (1)
Epitopes (3), (2), (1), (1)
Beacon