MPPE1 antibody (N-Term)

Catalog No. ABIN635730

Product Details anti-MPPE1 Antibody

Target: MPPE1 (Metallophosphoesterase 1 (MPPE1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPPE1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MPPE1 antibody was raised against the N terminal of MPPE1

Purification: Affinity purified

Immunogen: MPPE1 antibody was raised using the N terminal of MPPE1 corresponding to a region with amino acids WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPPE1 Blocking Peptide, catalog no. 33R-9972, is also available for use as a blocking control in assays to test for specificity of this MPPE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPPE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPPE1

Target: MPPE1 (Metallophosphoesterase 1 (MPPE1))

Alternative Name: MPPE1 (MPPE1 Products)

Synonyms: zgc:112219 antibody, PGAP5 antibody, A530095G11 antibody, pgap5 antibody, MPPE1 antibody, metallophosphoesterase 1 antibody, metallophosphoesterase 1 L homeolog antibody, MPPE1 antibody, mppe1 antibody, CpipJ_CPIJ008075 antibody, Bm1_07905 antibody, Tsp_09516 antibody, Mppe1 antibody, mppe1.L antibody

Background: The specific function of MPPE1 is not yet known.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Inositol Metabolic Process