Metallophosphoesterase 1 (MPPE1) antibody

Antigen: Metallophosphoesterase 1 (MPPE1)

Synonyms: PGAP5, A530095G11, zgc:112219, MGC154487, DKFZp469A1417

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Fruit Fly (Drosophila melanogaster)

Application: Western Blotting (WB)

Catalog no.: ABIN406079

Additional Information

Alternative name: Metallophosphoesterase 1

Gene ID: MPPE1

UniProt: Q53F39

Immunogen: The immunogen for anti-MPPE1 antibody: synthetic peptide directed towards the N terminal of human MPPE1

Sequence: WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHP SHVQLKVVAG

Cross-Reactivity: Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MPPE1 antibody concentration is 1 mg/ml.

Description: The specific function of MPPE1 is not yet known.

Characteristics: Antigen Size: 396 amino acids

Molecular Weight: 40kDa

Application Details

Application Notes: WB Suggested Anti-MPPE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MPPE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Publications

Product: Fortna, Kim, MacLaren et al.: "Lineage-specific gene duplication and loss in human and great ape evolution." in: PLoS biology, Vol. 2, Issue 7, pp. E207, 2004 (PubMed).