Protein Kinase-Like Protein SgK196 (SGK196) antibody

Antigen: Protein Kinase-Like Protein SgK196 (SGK196)

Synonyms: SGK196, FLJ23356, MGC126597, Sgk196, MGC114531, RGD1310810, sgk196, wu:fc58e12, MGC151666

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN406096

Additional Information

Alternative name: SGK196

Gene ID: FLJ23356

Immunogen: The immunogen for anti-FLJ23356 antibody: synthetic peptide directed towards the N terminal of human FLJ23356

Sequence: CEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSL EMKDDFLHGL

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FLJ23356 antibody concentration is 1 mg/ml.

Description: The exact function of FLJ23356 remains unknown.

Characteristics: Antigen Size: 350 amino acids

Molecular Weight: 40kDa

Application Details

Application Notes: WB Suggested Anti-FLJ23356 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-FLJ23356 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Publications

Product: Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).