Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3) antibody

Antigen: Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN406124

Additional Information

Alternative name: UBA3 / UBE1C

Gene ID: UBA3

UniProt: Q8TBC4

Immunogen: The immunogen for anti-UBA3 antibody: synthetic peptide directed towards the N terminal of human UBA3

Sequence: EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLV IGAGGLGCEL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-UBA3 antibody concentration is 1 mg/ml.

Description: UBA3 is a catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. UBA3 down-regulates steroid receptor activity. UBA3 is necessary for cell cycle progression.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Characteristics: Antigen Size: 463 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-UBA3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Pancreas.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-UBA3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Pancreas

Sample Type: 1. Human NT-2 cells (60ug)
2. mouse brain extracts (80ug)
Primary Antibody Dilution: 2ug/ml
Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution: 1: 20,000
Image Submitted by: Yuzhi Chen
University of Arkansas for Medical Science

Publications

Product: Li, Santockyte, Shen et al.: "A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers." in: Archives of biochemistry and biophysics, Vol. 453, Issue 1, pp. 70-4, 2006 (PubMed).