Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406142

Hyaluronidase-1 (HYAL1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HYAL-1, LUCA1, NAT6, Hya1, Hyal-1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Pig (Porcine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN406142
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1
Sequence WNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFY SSQLGTYPYY
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Pig : 92%, Rabbit : 92%, Dog : 85%, Bovine : 83%
Characteristics This is a rabbit polyclonal antibody against HYAL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HYAL1
Background HYAL1 is a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in HYAL1 are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. HYAL1 is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for HYAL1.This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 45kDa
Gene ID 3373
NCBI Accession NP_695014, NM_153282
UniProt Q12794
Research Area Cancer, Extracellular Matrix
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HYAL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Poola, Abraham, Marshalleck et al.: "Molecular risk assessment for breast cancer development in patients with ductal hyperplasias." in: Clinical cancer research : an official journal of the American Association for Cancer Research, Vol. 14, Issue 4, pp. 1274-80, 2008 (PubMed).

Alternatives for antigen "Hyaluronidase-1 (HYAL1)", type "Antibodies"
Hosts (35), (12), (5)
Reactivities (46), (18), (17), (6), (3), (3)
Applications (31), (27), (12), (10), (10), (4), (2), (2), (2), (2)
Conjugates (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (4), (3), (3), (2), (2), (2), (2)
Beacon