Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 2 Open Reading Frame 60 (C2orf60) antibody

Antigen

Chromosome 2 Open Reading Frame 60 (C2orf60)

Synonyms FLJ37953, MGC70509, C2orf60, JMJD5
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Rat (Rattus), Mouse (Murine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN406156
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C2orf60
Gene ID C2orf60
UniProt A2RUC4
Immunogen The immunogen for anti-C2orf60 antibody: synthetic peptide directed towards the middle region of human C2orf60
Sequence NKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHI QDKAYSKNSE
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C2orf60 antibody concentration is 1 mg/ml.
Description The function of the C2orf60 protein remains unknown.
Characteristics Antigen Size: 315 amino acids
Molecular Weight 36kDa

Application Details

Application Notes WB Suggested Anti-C2orf60 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 2 Open Reading Frame 60 (C2orf60)", type "Antibodies"
Hosts Rabbit (25)
Reactivities Human (25), Dog (Canine) (19), Mouse (Murine) (19), Rat (Rattus) (19), Chicken (1), Zebrafish (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (10), ELISA (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Center (2), Internal Region (2)