Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 4 Open Reading Fram 46 (C4orf46) (Middle Region) antibody

Details for Product No. ABIN406186
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
(8), (7), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(23), (1)
Host
Rabbit
(23)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (10), (10), (3)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406186
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LOC201725
Sequence VSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEAT SAVSAQVEEL
Predicted Reactivity Human : 100 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against LOC201725. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C4orf46
Background The specific function of LOC201725 is not yet known.
Molecular Weight 12 kDa
Gene ID 201725
NCBI Accession NM_001008393, NP_001008394
UniProt Q504U0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 113 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 4 Open Reading Fram 46 (C4orf46) (Middle Region) antibody WB Suggested Anti-C4orf46 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406186
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top