Did you know that you can buy products from over 140 different suppliers from us?

Exocyst Complex Component 3 (EXOC3) (Middle Region) antibody

Details for Product No. ABIN406206
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
Sec6, rSec6, Sec6l1, SEC6, Sec6p, SEC6L1, 2810050O03Rik, E430013E20Rik, fi26g09, sec6l1, wu:fi26g09, wu:fi34a09, wu:fj62h05, wu:fk66f08, zgc:55709, CG5341, Dmel\\CG5341, Dsec6, dsec6, sec 6, F14O23.20 ... show more
Sec6, rSec6, Sec6l1, SEC6, Sec6p, SEC6L1, 2810050O03Rik, E430013E20Rik, fi26g09, sec6l1, wu:fi26g09, wu:fi34a09, wu:fj62h05, wu:fk66f08, zgc:55709, CG5341, Dmel\\CG5341, Dsec6, dsec6, sec 6, F14O23.20, F14O23_20 show less
Epitope
Middle Region
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(18), (14), (13), (12), (12), (1), (1)
Host
Rabbit
(17), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (5), (4), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406206
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EXOC3
Sequence LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLI VAKNLMVQCF
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against EXOC3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EXOC3
Background EXOC3 is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.
Molecular Weight 85 kDa
Gene ID 11336
NCBI Accession NM_007277, NP_009208
UniProt Q6P2E8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 745 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Exocyst Complex Component 3 (EXOC3) (Middle Region) antibody WB Suggested Anti-EXOC3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Hsu, TerBush, Abraham et al.: "The exocyst complex in polarized exocytosis." in: International review of cytology, Vol. 233, pp. 243-65, 2004 (PubMed).

Hosts (17), (5)
Reactivities (18), (14), (13), (12), (12), (1), (1)
Applications (13), (10), (5), (4), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406206
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top