Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406240

Amyotrophic Lateral Sclerosis 2 (Juvenile) Chromosome Region, Candidate 12 (ALS2CR12) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGC142941
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406240
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ALS2CR12 antibody: synthetic peptide directed towards the N terminal of human ALS2CR12
Sequence SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNK SFYEVINVSP
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ALS2CR12. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ALS2CR12
Background The exact function of ALS2CR12 remains unknown.
Molecular Weight 52kDa
Gene ID 130540
NCBI Accession NP_631902, NM_139163
UniProt Q96Q35
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ALS2CR12 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hadano, Hand, Osuga et al.: "A gene encoding a putative GTPase regulator is mutated in familial amyotrophic lateral sclerosis 2." in: Nature genetics, Vol. 29, Issue 2, pp. 166-73, 2001 (PubMed).

Alternatives for antigen "Amyotrophic Lateral Sclerosis 2 (Juvenile) Chromosome Region, Candidate 12 (ALS2CR12)", type "Antibodies"
Hosts (6)
Reactivities (5)
Applications (6), (1)
Epitopes (4)
Beacon