Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) antibody

Antigen

DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1)
Synonyms RIG, GBTS1, Di-Ras1, FLJ42681, Gbts1, diras1, fi18d11, zgc:55360, wu:fi18d11, rig, gbts1, di-ras1, MGC146486
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN406266
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name DIRAS1
Gene ID DIRAS1
UniProt O95057
Immunogen The immunogen for anti-DIRAS1 antibody: synthetic peptide directed towards the N terminal of human DIRAS1
Sequence PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIE DTYRQVISCD
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-DIRAS1 antibody concentration is 1 mg/ml.
Description DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS, MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3390 BC030660.1 2-3391
Characteristics Antigen Size: 198 amino acids
Molecular Weight 22kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-DIRAS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1)", type "Antibodies"
Hosts Rabbit (31), Goat (2)
Reactivities Human (29), Mouse (Murine) (23), Rat (Rattus) (22), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1), Zebrafish (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (16), ELISA (13), Immunohistochemistry (IHC) (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Flow Cytometry (FACS) (2), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (1), Center (1), Internal Region (1), N-Term (1)