DIRAS1 antibody (N-Term)

Catalog No. ABIN634394

Product Details anti-DIRAS1 Antibody

Target: DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DIRAS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DIRAS1 antibody was raised against the N terminal of DIRAS1

Purification: Affinity purified

Immunogen: DIRAS1 antibody was raised using the N terminal of DIRAS1 corresponding to a region with amino acids PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DIRAS1 Blocking Peptide, catalog no. 33R-7059, is also available for use as a blocking control in assays to test for specificity of this DIRAS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DIRAS1

Target: DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))

Alternative Name: DIRAS1 (DIRAS1 Products)

Synonyms: Di-Ras1 antibody, GBTS1 antibody, RIG antibody, Gbts1 antibody, diras1 antibody, fi18d11 antibody, wu:fi18d11 antibody, zgc:55360 antibody, si:dkey-97k23.2 antibody, rig antibody, gbts1 antibody, di-ras1 antibody, MGC146486 antibody, DIRAS family GTPase 1 antibody, DIRAS family, GTP-binding RAS-like 1 antibody, DIRAS family, GTP-binding RAS-like 1a antibody, DIRAS family, GTP-binding RAS-like 1b antibody, DIRAS family GTP binding RAS like 1 antibody, DIRAS1 antibody, Diras1 antibody, diras1a antibody, diras1b antibody, diras1 antibody

Background: DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly