Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1) antibody

Antigen: Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1)

Synonyms: 2600017J23Rik, FLJ39932, MGC17791

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN406285

Additional Information

Alternative name: TNFAIP8L1

Gene ID: TNFAIP8L1

UniProt: Q8WVP5

Immunogen: The immunogen for anti-TNFAIP8L1 antibody: synthetic peptide directed towards the middle region of human TNFAIP8L1

Sequence: AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEG LGRMLDEGSL

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TNFAIP8L1 antibody concentration is 1 mg/ml.

Description: TNFAIP8L1 belongs to the TNFAIP8 family. The exact function of TNFAIP8L is not known.

Characteristics: Antigen Size: 186 amino acids

Molecular Weight: 21kDa

Application Details

Application Notes: WB Suggested Anti-TNFAIP8L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TNFAIP8L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Publications

Product: Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).