Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406352

T-Complex-Associated-Testis-Expressed 1 (TCTE1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms D6S46, D17Sil1, Tcte-1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406352
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCTE1 antibody: synthetic peptide directed towards the middle region of human TCTE1
Sequence MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDD DKARIIIRSL
Predicted Reactivity Human : 100%, Mouse : 100%, Dog : 92%, Horse : 92%, Rat : 92%, Chicken : 78%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against TCTE1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TCTE1
Background TCTE1 contains 7 LRR (leucine-rich) repeats. The exact function of TCTE1 remains unknown.
Molecular Weight 56kDa
Gene ID 202500
NCBI Accession NP_872345, NM_182539
UniProt Q5JU00
Research Area Reproduction
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TCTE1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Watanabe, Fujiwara, Shimizu et al.: "Cloning, expression, and mapping of TCTEL1, a putative human homologue of murine Tcte1, to 6q." in: Cytogenetics and cell genetics, Vol. 73, Issue 1-2, pp. 153-6, 1996 (PubMed).

Alternatives for antigen "T-Complex-Associated-Testis-Expressed 1 (TCTE1)", type "Antibodies"
Hosts (3)
Reactivities (2), (1), (1), (1), (1)
Applications (3), (1)
Epitopes (1), (1)
Beacon