TCTE1 antibody (Middle Region)

Catalog No. ABIN632172

Product Details anti-TCTE1 Antibody

Target: TCTE1 (T-Complex-Associated-Testis-Expressed 1 (TCTE1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TCTE1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TCTE1 antibody was raised against the middle region of TCTE1

Purification: Affinity purified

Immunogen: TCTE1 antibody was raised using the middle region of TCTE1 corresponding to a region with amino acids MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TCTE1 Blocking Peptide, catalog no. 33R-6244, is also available for use as a blocking control in assays to test for specificity of this TCTE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TCTE1

Target: TCTE1 (T-Complex-Associated-Testis-Expressed 1 (TCTE1))

Alternative Name: TCTE1 (TCTE1 Products)

Synonyms: D17Sil1 antibody, Tcte-1 antibody, D6S46 antibody, t-complex-associated-testis-expressed 1 antibody, t-complex-associated testis expressed 1 antibody, TCTE1 antibody, Tcte1 antibody

Background: TCTE1 contains 7 LRR (leucine-rich) repeats. The exact function of TCTE1 remains unknown.

Molecular Weight: 56 kDa (MW of target protein)