Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406363

rho GTPase Activating Protein 28 (ARHGAP28) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AU044757, AW550892, E130310N06, RGD1559882, ARHGAP28
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406363
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ARHGAP28 antibody: synthetic peptide directed towards the N terminal of human ARHGAP28
Sequence KEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAI SDDDFLEKNI
Predicted Reactivity Human : 100%, Dog : 85%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against ARHGAP28. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ARHGAP28
Background ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Molecular Weight 63kDa
Gene ID 79822
NCBI Accession NP_001010000, NM_001010000
UniProt A8MQB7
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ARHGAP28 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nusbaum, Zody, Borowsky et al.: "DNA sequence and analysis of human chromosome 18." in: Nature, Vol. 437, Issue 7058, pp. 551-5, 2005 (PubMed).

Alternatives for antigen "rho GTPase Activating Protein 28 (ARHGAP28)", type "Antibodies"
Hosts (11), (1)
Reactivities (10)
Applications (12), (2), (1)
Epitopes (5), (2), (1), (1), (1), (1), (1)
Beacon