Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406367

Transducin (Beta)-Like 2 (TBL2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms WBSCR13, WS-betaTRP, C76179, WS-bTRP, wu:fa96f08, tbl2, MGC53692, TBL2, MGC79804, MGC140759, DKFZp469O1728
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406367
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TBL2 antibody: synthetic peptide directed towards the N terminal of human TBL2
Sequence RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNF THRLLAAALK
Predicted Reactivity Human : 100%, Horse : 85%, Rabbit : 85%, Mouse : 84%
Characteristics This is a rabbit polyclonal antibody against TBL2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TBL2
Background TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. This gene encodes a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.
Molecular Weight 49kDa
Gene ID 26608
NCBI Accession NP_036585, NM_012453
UniProt Q9Y4P3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TBL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kathiresan, Melander, Guiducci et al.: "Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans." in: Nature genetics, Vol. 40, Issue 2, pp. 189-97, 2008 (PubMed).

Alternatives for antigen "Transducin (Beta)-Like 2 (TBL2)", type "Antibodies"
Hosts (17), (3)
Reactivities (19), (2), (2)
Applications (19), (9), (6), (4), (1), (1)
Epitopes (5), (4), (2), (2), (1), (1)
Beacon