Transducin (Beta)-Like 2 (TBL2) (N-Term) antibody

Details for Product No. ABIN406367
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms WBSCR13, WS-betaTRP, C76179, WS-bTRP, wu:fa96f08, tbl2, MGC53692, TBL2, MGC79804, MGC140759, DKFZp469O1728
Epitope
N-Term
(4), (2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Human
(21), (3), (3)
Host
Rabbit
(19), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(21), (10), (4), (4), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN406367
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TBL2
Sequence RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNF THRLLAAALK
Predicted Reactivity Human : 100 %, Horse : 80 %, Rabbit : 80 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against TBL2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TBL2
Background TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. This gene encodes a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.
Molecular Weight 49 kDa
Gene ID 26608
NCBI Accession NM_012453, NP_036585
UniProt Q9Y4P3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 447 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transducin (Beta)-Like 2 (TBL2) (N-Term) antibody WB Suggested Anti-TBL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
Background publications Kathiresan, Melander, Guiducci et al.: "Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans." in: Nature genetics, Vol. 40, Issue 2, pp. 189-97, 2008 (PubMed).

Hosts (19), (3)
Reactivities (21), (3), (3)
Applications (21), (10), (4), (4), (2), (1)
Epitopes (4), (2), (2), (2), (1), (1)
back to top